DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9876 and Vsx1

DIOPT Version :9

Sequence 1:NP_611756.1 Gene:CG9876 / 37668 FlyBaseID:FBgn0034821 Length:275 Species:Drosophila melanogaster
Sequence 2:NP_001284898.1 Gene:Vsx1 / 31470 FlyBaseID:FBgn0263511 Length:837 Species:Drosophila melanogaster


Alignment Length:122 Identity:50/122 - (40%)
Similarity:65/122 - (53%) Gaps:9/122 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 HDAYSKGKMAMELSSNFGPTGAGCGGADRP--APCSGNL---PAG---GGHHSRKPRRNRTTFSS 126
            |.|::....|....:..|..| |.||....  |...|::   |.|   ||....|.|..||.|:|
  Fly   341 HAAHAAHAHAHHAEAFLGAAG-GAGGNPNSLLAAHGGDVLVGPGGTGPGGKKKNKRRHGRTIFTS 404

  Fly   127 AQLTALEKVFERTHYPDAFVREELATKVHLSEARVQVWFQNRRAKFRRNERSVGSRT 183
            :||..|||.|:..||||...||.|:.|..|:|.|:|||:||||||:|:.|:..|..|
  Fly   405 SQLEELEKAFKEAHYPDVSARELLSMKTGLAEDRIQVWYQNRRAKWRKTEKCWGHST 461

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9876NP_611756.1 Homeobox 121..173 CDD:278475 30/51 (59%)
Vsx1NP_001284898.1 Homeobox 399..451 CDD:278475 30/51 (59%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45450897
Domainoid 1 1.000 55 1.000 Domainoid score I4097
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.