DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9876 and arxa

DIOPT Version :10

Sequence 1:NP_611756.1 Gene:CG9876 / 37668 FlyBaseID:FBgn0034821 Length:275 Species:Drosophila melanogaster
Sequence 2:NP_571459.1 Gene:arxa / 30657 ZFINID:ZDB-GENE-990415-15 Length:453 Species:Danio rerio


Alignment Length:142 Identity:62/142 - (43%)
Similarity:78/142 - (54%) Gaps:26/142 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   106 LPAGG----GHHSRKPRRNRTTFSSAQLTALEKVFERTHYPDAFVREELATKVHLSEARVQVWFQ 166
            |.||.    |...||.||.||||:|.||..||:.|::|||||.|.|||||.::.|:|||||||||
Zfish   200 LSAGSDSEEGMLKRKQRRYRTTFTSYQLEELERAFQKTHYPDVFTREELAMRLDLTEARVQVWFQ 264

  Fly   167 NRRAKFRRNERSVGSRT----LLDTAPQLVPAPISNNMHKYANMPHPHPQ--------------- 212
            |||||:|:.|:: |.:.    |....|.....|:|:.:......|||||.               
Zfish   265 NRRAKWRKREKA-GVQAHPTGLPFPGPLAAAHPLSHYLEGGPFPPHPHPALESAWTAAAAAAAAF 328

  Fly   213 P--PPPPGAYAL 222
            |  .|||.:.||
Zfish   329 PGLAPPPNSSAL 340

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9876NP_611756.1 Homeodomain 118..174 CDD:459649 38/55 (69%)
arxaNP_571459.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..21
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 49..75
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 124..149
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 170..212 4/11 (36%)
Homeodomain 216..272 CDD:459649 38/55 (69%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 390..418
OAR 417..435 CDD:461067
OAR. /evidence=ECO:0000255|PROSITE-ProRule:PRU00138 421..434
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.