DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9876 and dlx6a

DIOPT Version :10

Sequence 1:NP_611756.1 Gene:CG9876 / 37668 FlyBaseID:FBgn0034821 Length:275 Species:Drosophila melanogaster
Sequence 2:NP_571398.1 Gene:dlx6a / 30586 ZFINID:ZDB-GENE-980526-448 Length:247 Species:Danio rerio


Alignment Length:125 Identity:43/125 - (34%)
Similarity:61/125 - (48%) Gaps:26/125 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   109 GGGHHSRKPRRNRTTFSSAQLTALEKVFERTHYPDAFVREELATKVHLSEARVQVWFQNRRAKFR 173
            |.|...|||   ||.:||.||.||...|::|.|.....|.|||..:.|::.:|::||||:|:||:
Zfish   120 GKGKKIRKP---RTIYSSLQLQALNHRFQQTQYLALPERAELAASLGLTQTQVKIWFQNKRSKFK 181

  Fly   174 RNERSVGSRTLLDTAPQLV------PA--PISN--------NMHKYANMP-------HPH 210
            :..:..|:....||.|..:      ||  ||.:        ||...:.||       .||
Zfish   182 KLLKQGGNPHETDTLPGSIALSPRSPAIPPIWDVSASSKGVNMSANSYMPGYSHWYSSPH 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9876NP_611756.1 Homeodomain 118..174 CDD:459649 24/55 (44%)
dlx6aNP_571398.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 22..66
Homeodomain 126..182 CDD:459649 27/58 (47%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.