DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9876 and dlx1a

DIOPT Version :10

Sequence 1:NP_611756.1 Gene:CG9876 / 37668 FlyBaseID:FBgn0034821 Length:275 Species:Drosophila melanogaster
Sequence 2:NP_571380.1 Gene:dlx1a / 30568 ZFINID:ZDB-GENE-990415-48 Length:252 Species:Danio rerio


Alignment Length:111 Identity:38/111 - (34%)
Similarity:57/111 - (51%) Gaps:16/111 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    99 PAPCS-GNLPAGGGH-----HSRKPRRNRTTFSSAQLTALEKVFERTHYPDAFVREELATKVHLS 157
            |||.| .|....||.     ..:|.|:.||.:||.||.||.:.|::|.|.....|.|||..:.|:
Zfish   104 PAPESEKNTVVEGGEVRFNGKGKKIRKPRTIYSSLQLQALNRRFQQTQYLALPERAELAASLGLT 168

  Fly   158 EARVQVWFQNRRAKFRRNERSVG----------SRTLLDTAPQLVP 193
            :.:|::||||:|:||::..:..|          .|.|...:|.:.|
Zfish   169 QTQVKIWFQNKRSKFKKLMKQGGGTIDTNALANGRGLSTGSPSVAP 214

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9876NP_611756.1 Homeodomain 118..174 CDD:459649 25/55 (45%)
dlx1aNP_571380.1 Homeodomain 129..185 CDD:459649 25/55 (45%)

Return to query results.
Submit another query.