DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9876 and otx1

DIOPT Version :10

Sequence 1:NP_611756.1 Gene:CG9876 / 37668 FlyBaseID:FBgn0034821 Length:275 Species:Drosophila melanogaster
Sequence 2:NP_571325.2 Gene:otx1 / 30500 ZFINID:ZDB-GENE-980526-400 Length:323 Species:Danio rerio


Alignment Length:176 Identity:64/176 - (36%)
Similarity:86/176 - (48%) Gaps:40/176 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    86 FGPTGAGCGGA--DRPAPCSGNLPAGGGHHSRKPRRNRTTFSSAQLTALEKVFERTHYPDAFVRE 148
            :...|.|..||  |...|..| .||    ..||.||.||||:.:||..||.:|.:|.|||.|:||
Zfish    10 YAMNGLGLSGAAMDLLHPSVG-YPA----TPRKQRRERTTFTRSQLDILEALFAKTRYPDIFMRE 69

  Fly   149 ELATKVHLSEARVQVWFQNRRAKFRRNERSVGSRTLLDTAPQLVPAPISNNMHKYANMPHPHPQP 213
            |:|.|::|.|:||||||:|||||.|:.::| ||.|      :..||...::..:.:.......|.
Zfish    70 EVALKINLPESRVQVWFKNRRAKCRQQQQS-GSST------KTRPAKKKSSPTRESTGSESSGQF 127

  Fly   214 PPPPGAYALNFGPLELRSCQNYTNCYGGFGSSGASGS-----GVCS 254
            .||..:.|                     |||.:|.|     |:||
Zfish   128 TPPAVSSA---------------------GSSSSSSSSTNNTGICS 152

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9876NP_611756.1 Homeodomain 118..174 CDD:459649 34/55 (62%)
otx1NP_571325.2 Homeodomain 39..95 CDD:459649 34/55 (62%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 91..155 21/90 (23%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 168..204
TF_Otx 172..258 CDD:427350
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 239..277
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.