DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9876 and dbx1b

DIOPT Version :10

Sequence 1:NP_611756.1 Gene:CG9876 / 37668 FlyBaseID:FBgn0034821 Length:275 Species:Drosophila melanogaster
Sequence 2:NP_571253.1 Gene:dbx1b / 30416 ZFINID:ZDB-GENE-000128-11 Length:322 Species:Danio rerio


Alignment Length:93 Identity:37/93 - (39%)
Similarity:55/93 - (59%) Gaps:16/93 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   116 KPRR---NRTTFSSAQLTALEKVFERTHY---PDAFVREELATKVHLSEARVQVWFQNRRAKFRR 174
            ||||   .|..||..|..||||:|::..|   ||   |::||||:.|.:::|::||||||.|:|.
Zfish   175 KPRRGMLRRAVFSDVQRKALEKMFQKQKYISKPD---RKKLATKLGLKDSQVKIWFQNRRMKWRN 236

  Fly   175 NERSVGSRTLLDTA---PQLVPAPISNN 199
            ::    .|.||.:.   .|.:|..::.|
Zfish   237 SK----ERELLSSGGCREQTLPTKMNPN 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9876NP_611756.1 Homeodomain 118..174 CDD:459649 28/61 (46%)
dbx1bNP_571253.1 COG5576 <173..296 CDD:227863 37/93 (40%)
Homeodomain 182..236 CDD:459649 26/56 (46%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 238..266 6/27 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 296..322
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.