DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9876 and dbx1a

DIOPT Version :10

Sequence 1:NP_611756.1 Gene:CG9876 / 37668 FlyBaseID:FBgn0034821 Length:275 Species:Drosophila melanogaster
Sequence 2:NP_571233.1 Gene:dbx1a / 30394 ZFINID:ZDB-GENE-000128-8 Length:314 Species:Danio rerio


Alignment Length:229 Identity:63/229 - (27%)
Similarity:92/229 - (40%) Gaps:60/229 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 HSLPVGNPGNFYYGPTVSGEIYSSHQSHNLESEDKLED-----------------REESGRNLDK 56
            :|.|:..|.|......||..|...|...:.::....:|                 :..|..::..
Zfish    61 NSTPLSIPDNCRILDRVSPGITEKHGPCSPKTPVSSKDPTYLKFGVSAILAPSPKKATSPPSVHS 125

  Fly    57 IH--RFSVDNIMEMKHDAYSKGKMAMELSSNFGPTGAGCGGADRPAPCSGNLPAGGGHHSRKPRR 119
            ||  .|||         .|..|.....:.|::.|  |.......|...|..|.|.|     ||||
Zfish   126 IHPKGFSV---------PYFDGSFCPFVRSSYFP--APSSVVPIPGTFSWPLAARG-----KPRR 174

  Fly   120 ---NRTTFSSAQLTALEKVFERTHY---PDAFVREELATKVHLSEARVQVWFQNRRAKFRRNERS 178
               .|..||..|..||||:|::..|   ||   |::||.|:.|.:::|::||||||.|:|.::  
Zfish   175 GMLRRAVFSDVQRKALEKMFQKQKYISKPD---RKKLAAKLGLKDSQVKIWFQNRRMKWRNSK-- 234

  Fly   179 VGSRTLLDTA---PQLVPAPISNNMHKYANMPHP 209
              .|.||.:.   .|.:|...:         |||
Zfish   235 --ERELLSSGGCREQTLPTKTN---------PHP 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9876NP_611756.1 Homeodomain 118..174 CDD:459649 27/61 (44%)
dbx1aNP_571233.1 Homeodomain 178..232 CDD:459649 25/56 (45%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 234..279 8/37 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 292..314
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.