DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9876 and hoxb4a

DIOPT Version :10

Sequence 1:NP_611756.1 Gene:CG9876 / 37668 FlyBaseID:FBgn0034821 Length:275 Species:Drosophila melanogaster
Sequence 2:NP_571193.1 Gene:hoxb4a / 30340 ZFINID:ZDB-GENE-990415-105 Length:246 Species:Danio rerio


Alignment Length:115 Identity:34/115 - (29%)
Similarity:55/115 - (47%) Gaps:24/115 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   108 AGGGHHSRKPRRNRTTFSSAQLTALEKVFERTHYPDAFVREELATKVHLSEARVQVWFQNRRAKF 172
            :||     :|:|:||.::..|:..|||.|....|.....|.|:|..:.|||.::::||||||.|:
Zfish   147 SGG-----EPKRSRTAYTRQQVLELEKEFHYNRYLTRRRRVEIAHTLCLSERQIKIWFQNRRMKW 206

  Fly   173 RRNE-------RSVGSRTLLDTAPQLVPAPISNNMHKYANMPHPHPQPPP 215
            :::.       ||..:.|.....|.|     .:|..:.:.       |||
Zfish   207 KKDHKLPNTKIRSNSASTNSSGCPTL-----CSNQSRASG-------PPP 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9876NP_611756.1 Homeodomain 118..174 CDD:459649 22/55 (40%)
hoxb4aNP_571193.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 23..125
Antp-type hexapeptide 130..135
Homeodomain 152..208 CDD:459649 22/55 (40%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 210..246 9/47 (19%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.