DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9876 and isl2b

DIOPT Version :9

Sequence 1:NP_611756.1 Gene:CG9876 / 37668 FlyBaseID:FBgn0034821 Length:275 Species:Drosophila melanogaster
Sequence 2:NP_571039.1 Gene:isl2b / 30151 ZFINID:ZDB-GENE-990415-133 Length:358 Species:Danio rerio


Alignment Length:203 Identity:60/203 - (29%)
Similarity:84/203 - (41%) Gaps:53/203 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    92 GCGGADRPAPCS-GNLPAGGGH-------------------HSRKPRRNRTTFSSAQLTALEKVF 136
            |.||    :|.| ||:...|.|                   .|.|..|.||..:..||..|...:
Zfish   150 GPGG----SPLSPGNIHTRGLHMAADPVSVRQTPHRNHVHKQSEKTTRVRTVLNEKQLHTLRTCY 210

  Fly   137 ERTHYPDAFVREELATKVHLSEARVQVWFQNRRAKFRRNERSV---------GSRTLLD--TAPQ 190
            .....|||.::|:|.....||...::|||||:|.|.::  ||:         |.:|.|.  |...
Zfish   211 NANPRPDALMKEQLVEMTGLSPRVIRVWFQNKRCKDKK--RSILMKQLQQQHGDKTNLQGMTGTA 273

  Fly   191 LVP-APISNNMHKYANMPHPHP------QPP-PPPGAYALNFGPLELRSCQNYTNCYGGFGSSG- 246
            ||. :||.:|    .::| .||      ||| .....:||. ..|:..:.|...: :...||.| 
Zfish   274 LVAGSPIRHN----PSVP-GHPVDVQAYQPPWKALSEFALQ-SDLDQPAFQQLVS-FSESGSLGN 331

  Fly   247 ASGSGVCS 254
            :|||.|.|
Zfish   332 SSGSDVTS 339

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9876NP_611756.1 Homeobox 121..173 CDD:278475 19/51 (37%)
isl2bNP_571039.1 LIM1_Isl 27..81 CDD:188752
LIM2_Isl2 89..143 CDD:188855
HOX 191..247 CDD:197696 20/55 (36%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 325..358 8/15 (53%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.