DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9876 and mixl1

DIOPT Version :10

Sequence 1:NP_611756.1 Gene:CG9876 / 37668 FlyBaseID:FBgn0034821 Length:275 Species:Drosophila melanogaster
Sequence 2:NP_571015.3 Gene:mixl1 / 30115 ZFINID:ZDB-GENE-000208-20 Length:327 Species:Danio rerio


Alignment Length:89 Identity:40/89 - (44%)
Similarity:54/89 - (60%) Gaps:10/89 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   118 RRNRTTFSSAQLTALEKVFERTHYPDAFVREELATKVHLSEARVQVWFQNRRAKFRRNER-SVGS 181
            ||.||.|:..|:..||||:..|.|||.::||:|.....|.|:|:||||||||||.||... |:.:
Zfish    59 RRKRTNFTQQQIDVLEKVYLDTKYPDIYLREKLEALTGLPESRIQVWFQNRRAKSRRQVGISIPN 123

  Fly   182 RTLLDTAPQLVPAPISNN--MHKY 203
            :|   :...|.|    ||  ||::
Zfish   124 KT---SGNILTP----NNLLMHQF 140

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9876NP_611756.1 Homeodomain 118..174 CDD:459649 30/55 (55%)
mixl1NP_571015.3 Homeodomain 59..115 CDD:459649 30/55 (55%)

Return to query results.
Submit another query.