DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9876 and Rhox11

DIOPT Version :10

Sequence 1:NP_611756.1 Gene:CG9876 / 37668 FlyBaseID:FBgn0034821 Length:275 Species:Drosophila melanogaster
Sequence 2:NP_001020044.1 Gene:Rhox11 / 298346 RGDID:1564332 Length:215 Species:Rattus norvegicus


Alignment Length:65 Identity:29/65 - (44%)
Similarity:43/65 - (66%) Gaps:4/65 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   115 RKPRRNRTTFSSAQLTALEKVFERTHYPDAFVREELATKVHLSEARVQVWFQNRRAKFRRNERSV 179
            |||.:    |:..||..::.|||.|.|||||.|:|||..:::.|.:|:.||.|:|||.|:.:|.:
  Rat    98 RKPYK----FTPGQLWEMQAVFEETQYPDAFRRKELAELMNVDEQKVKDWFNNKRAKLRKIQREI 158

  Fly   180  179
              Rat   159  158

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9876NP_611756.1 Homeodomain 118..174 CDD:459649 24/55 (44%)
Rhox11NP_001020044.1 COG5576 <76..185 CDD:227863 29/65 (45%)
Homeodomain 103..153 CDD:459649 24/49 (49%)

Return to query results.
Submit another query.