DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9876 and Prrx1

DIOPT Version :9

Sequence 1:NP_611756.1 Gene:CG9876 / 37668 FlyBaseID:FBgn0034821 Length:275 Species:Drosophila melanogaster
Sequence 2:NP_722543.1 Gene:Prrx1 / 266813 RGDID:628884 Length:245 Species:Rattus norvegicus


Alignment Length:200 Identity:85/200 - (42%)
Similarity:114/200 - (56%) Gaps:31/200 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 SSHQSHNLESEDKLEDREESGRNLDKIH---RFSVDNIMEMKHDAYSKGKM-AMELSSNFGPTGA 91
            :|...|.||.:..|..|.:|..|||.:.   .|||.::::::    ..|.| |.:...:.|..|.
  Rat     2 TSSYGHVLERQPALGGRLDSPGNLDTLQAKKNFSVSHLLDLE----EAGDMVAAQADESVGEAGR 62

  Fly    92 G-------CGGADRPAPCSGNLPAGGGHHSRKPRRNRTTFSSAQLTALEKVFERTHYPDAFVREE 149
            .       ..|:|.|...:..|.: .....||.|||||||:|:||.|||:||||||||||||||:
  Rat    63 SLLESPGLTSGSDTPQQDNDQLNS-EEKKKRKQRRNRTTFNSSQLQALERVFERTHYPDAFVRED 126

  Fly   150 LATKVHLSEARVQVWFQNRRAKFRRNERSV---GSRTLLDTAPQLVPA---PISNNMHKYANMPH 208
            ||.:|:|:||||||||||||||||||||::   .:.:||.:....|.|   ||         :|.
  Rat   127 LARRVNLTEARVQVWFQNRRAKFRRNERAMLANKNASLLKSYSGDVTAVEQPI---------VPR 182

  Fly   209 PHPQP 213
            |.|:|
  Rat   183 PAPRP 187

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9876NP_611756.1 Homeobox 121..173 CDD:278475 42/51 (82%)
Prrx1NP_722543.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..24 7/21 (33%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 54..103 15/49 (31%)
Homeobox 99..151 CDD:395001 42/51 (82%)
OAR 219..235 CDD:397759
OAR. /evidence=ECO:0000255|PROSITE-ProRule:PRU00138 222..235
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166347741
Domainoid 1 1.000 105 1.000 Domainoid score I6517
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 123 1.000 Inparanoid score I4636
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000011
OrthoInspector 1 1.000 - - otm45609
orthoMCL 1 0.900 - - OOG6_114029
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X3194
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1110.750

Return to query results.
Submit another query.