DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9876 and NKX2-8

DIOPT Version :10

Sequence 1:NP_611756.1 Gene:CG9876 / 37668 FlyBaseID:FBgn0034821 Length:275 Species:Drosophila melanogaster
Sequence 2:NP_055175.2 Gene:NKX2-8 / 26257 HGNCID:16364 Length:239 Species:Homo sapiens


Alignment Length:31 Identity:9/31 - (29%)
Similarity:17/31 - (54%) Gaps:0/31 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 VSLDRYQGSVCLIVNFSTKDATFEKVLSLLT 54
            :|:|||...|..:.:...:..|:..:.||:|
Human   238 MSIDRYLAIVHAVFSLKARTLTYGVITSLIT 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9876NP_611756.1 Homeodomain 118..174 CDD:459649
NKX2-8NP_055175.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..87
Homeodomain 85..141 CDD:459649
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.