| Sequence 1: | NP_611756.1 | Gene: | CG9876 / 37668 | FlyBaseID: | FBgn0034821 | Length: | 275 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_055175.2 | Gene: | NKX2-8 / 26257 | HGNCID: | 16364 | Length: | 239 | Species: | Homo sapiens |
| Alignment Length: | 31 | Identity: | 9/31 - (29%) |
|---|---|---|---|
| Similarity: | 17/31 - (54%) | Gaps: | 0/31 - (0%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 24 VSLDRYQGSVCLIVNFSTKDATFEKVLSLLT 54 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG9876 | NP_611756.1 | Homeodomain | 118..174 | CDD:459649 | |
| NKX2-8 | NP_055175.2 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..87 | ||
| Homeodomain | 85..141 | CDD:459649 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||