| Sequence 1: | NP_611756.1 | Gene: | CG9876 / 37668 | FlyBaseID: | FBgn0034821 | Length: | 275 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_037160.2 | Gene: | Shox2 / 25546 | RGDID: | 3674 | Length: | 331 | Species: | Rattus norvegicus |
| Alignment Length: | 208 | Identity: | 63/208 - (30%) |
|---|---|---|---|
| Similarity: | 78/208 - (37%) | Gaps: | 87/208 - (41%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 87 GPTGAGCGGADRPAPCSGNLPAGGGHHSRKP--------------------------------RR 119
Fly 120 NRTTFSSAQLTALEKVFERTHYPDAFVREELATKVHLSEARVQVWFQNRRAKFRRNERSVGSRTL 184
Fly 185 LDTAPQLVPAPISNNMHKYAN-----MP---------------------------------HPH- 210
Fly 211 ---------PQPP 214 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG9876 | NP_611756.1 | Homeodomain | 118..174 | CDD:459649 | 37/55 (67%) |
| Shox2 | NP_037160.2 | Homeodomain | 141..197 | CDD:459649 | 37/55 (67%) |
| OAR | 311..327 | CDD:461067 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||