DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9876 and Alx1

DIOPT Version :9

Sequence 1:NP_611756.1 Gene:CG9876 / 37668 FlyBaseID:FBgn0034821 Length:275 Species:Drosophila melanogaster
Sequence 2:NP_037053.1 Gene:Alx1 / 25401 RGDID:2273 Length:326 Species:Rattus norvegicus


Alignment Length:258 Identity:76/258 - (29%)
Similarity:108/258 - (41%) Gaps:76/258 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 PVGNPGNFYYGPTVSGEIYSSHQSHNLESEDKLEDREESGRNLDKI-------HRFSVDNIMEMK 69
            |.....:||.|  ..|.:  .|....|::| ....:..:|:.:...       |...:|.....:
  Rat    13 PPSKNSDFYMG--TGGAL--EHVMETLDNE-SFYGKATAGKCVQAFGPLPRAEHHVRLDRTSPCQ 72

  Fly    70 HDAYSKGKMAME---LSSNFGPTGAGCGGADRPAP----------------CSGNLPAGGGHHSR 115
            ..:.:.|...:|   |.:.......||... |.:|                |..|:      .|.
  Rat    73 DSSVNYGITKVEGQPLHTELNRAMDGCNNL-RMSPVKGMPEKSELDELGDKCDSNV------SSS 130

  Fly   116 KPRRNRTTFSSAQLTALEKVFERTHYPDAFVREELATKVHLSEARVQVWFQNRRAKFRRNER--- 177
            |.||:||||:|.||..|||||::|||||.:|||:||.:..|:||||||||||||||:|:.||   
  Rat   131 KKRRHRTTFTSLQLEELEKVFQKTHYPDVYVREQLALRTELTEARVQVWFQNRRAKWRKRERYGQ 195

  Fly   178 --------------SVGSRTLLDTAPQ-------------------LVPAPISNNMHKYANMP 207
                          ||..||  |:.||                   ::|...|:.|..|::.|
  Rat   196 IQQAKSHFAATYDISVLPRT--DSYPQIQNNLWAGNTSGGSVVTSCMLPRDASSCMTPYSHSP 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9876NP_611756.1 Homeobox 121..173 CDD:278475 37/51 (73%)
Alx1NP_037053.1 Homeobox 135..188 CDD:278475 37/52 (71%)
Transactivation domain. /evidence=ECO:0000269|PubMed:12390248 192..326 13/67 (19%)
OAR 302..319 CDD:281777
OAR. /evidence=ECO:0000255|PROSITE-ProRule:PRU00138 306..319
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24329
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.