DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9876 and Uncx

DIOPT Version :10

Sequence 1:NP_611756.1 Gene:CG9876 / 37668 FlyBaseID:FBgn0034821 Length:275 Species:Drosophila melanogaster
Sequence 2:NP_038730.1 Gene:Uncx / 22255 MGIID:108013 Length:530 Species:Mus musculus


Alignment Length:161 Identity:37/161 - (22%)
Similarity:51/161 - (31%) Gaps:51/161 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 LIVNFSTKDATFEKVLSLLTPLLRKY----------------HNDTRKDLNVL------------ 71
            :|..||.:.|.|     |..|..:||                |....|::.||            
Mouse   371 VITFFSRETAVF-----LELPQGQKYITAFQALRMHGITEWQHLQELKNIRVLPESWLLNILSNH 430

  Fly    72 FFPCFQFGSKESPDEIVQRFESSTDSSGMIGEIFTEIEVNGSKAPGLYKYLKAKKPGNCGGFINS 136
            :...:..|     |.:|..|.......||:.....|.........|.|..|:|.|.|      .|
Mouse   431 YHTLYSGG-----DMVVTDFSKQAIRFGMMLNQEQECCTQTINLYGFYFILQAAKMG------QS 484

  Fly   137 NFTIFLTDR-----QGVPVERLNAGIHPYTL 162
            |..||..:|     ..||  :.:|..|||.:
Mouse   485 NTYIFSIERLRHWDPAVP--QSSAVSHPYCM 513

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9876NP_611756.1 Homeodomain 118..174 CDD:459649 16/50 (32%)
UncxNP_038730.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 90..111
Homeodomain 110..166 CDD:459649
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 165..360
PRK07764 <380..530 CDD:236090 34/152 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 400..530 28/127 (22%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.