DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9876 and Alx1

DIOPT Version :9

Sequence 1:NP_611756.1 Gene:CG9876 / 37668 FlyBaseID:FBgn0034821 Length:275 Species:Drosophila melanogaster
Sequence 2:NP_766141.1 Gene:Alx1 / 216285 MGIID:104621 Length:326 Species:Mus musculus


Alignment Length:203 Identity:71/203 - (34%)
Similarity:92/203 - (45%) Gaps:78/203 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly   102 CSGNLPAGGGHHSRKPRRNRTTFSSAQLTALEKVFERTHYPDAFVREELATKVHLSEARVQVWFQ 166
            |..|:      .|.|.||:||||:|.||..|||||::|||||.:|||:||.:..|:|||||||||
Mouse   123 CDSNV------SSSKKRRHRTTFTSLQLEELEKVFQKTHYPDVYVREQLALRTELTEARVQVWFQ 181

  Fly   167 NRRAKFRRNER-----------------SVGSRTLLDTAPQ-------------------LVPAP 195
            |||||:|:.||                 ||..||  |:.||                   ::|..
Mouse   182 NRRAKWRKRERYGQIQQAKSHFAATYDISVLPRT--DSYPQIQNNLWAGNASGGSVVTSCMLPRD 244

  Fly   196 ISNNMHKYANMPHPHPQPPPPPGAYALNFGPLELRSCQNYTNCYGGFGSSGASGSGV--CSFF-- 256
            .|:.|..|::.|                      |:..:||    ||.:.....|.|  .:||  
Mouse   245 ASSCMTPYSHSP----------------------RTDSSYT----GFSNHQNQFSHVPLNNFFTD 283

  Fly   257 ----GATN 260
                ||||
Mouse   284 SLLTGATN 291

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9876NP_611756.1 Homeobox 121..173 CDD:278475 37/51 (73%)
Alx1NP_766141.1 Homeobox 135..189 CDD:395001 37/53 (70%)
Transactivation domain. /evidence=ECO:0000250|UniProtKB:Q63087 192..326 26/128 (20%)
OAR 302..320 CDD:397759
OAR. /evidence=ECO:0000255|PROSITE-ProRule:PRU00138 306..319
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24329
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.