DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9876 and Alx1

DIOPT Version :10

Sequence 1:NP_611756.1 Gene:CG9876 / 37668 FlyBaseID:FBgn0034821 Length:275 Species:Drosophila melanogaster
Sequence 2:NP_001408403.1 Gene:Alx1 / 216285 MGIID:104621 Length:377 Species:Mus musculus


Alignment Length:203 Identity:71/203 - (34%)
Similarity:92/203 - (45%) Gaps:78/203 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly   102 CSGNLPAGGGHHSRKPRRNRTTFSSAQLTALEKVFERTHYPDAFVREELATKVHLSEARVQVWFQ 166
            |..|:      .|.|.||:||||:|.||..|||||::|||||.:|||:||.:..|:|||||||||
Mouse   123 CDSNV------SSSKKRRHRTTFTSLQLEELEKVFQKTHYPDVYVREQLALRTELTEARVQVWFQ 181

  Fly   167 NRRAKFRRNER-----------------SVGSRTLLDTAPQ-------------------LVPAP 195
            |||||:|:.||                 ||..||  |:.||                   ::|..
Mouse   182 NRRAKWRKRERYGQIQQAKSHFAATYDISVLPRT--DSYPQIQNNLWAGNASGGSVVTSCMLPRD 244

  Fly   196 ISNNMHKYANMPHPHPQPPPPPGAYALNFGPLELRSCQNYTNCYGGFGSSGASGSGV--CSFF-- 256
            .|:.|..|::.|                      |:..:||    ||.:.....|.|  .:||  
Mouse   245 ASSCMTPYSHSP----------------------RTDSSYT----GFSNHQNQFSHVPLNNFFTD 283

  Fly   257 ----GATN 260
                ||||
Mouse   284 SLLTGATN 291

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9876NP_611756.1 Homeodomain 118..174 CDD:459649 39/55 (71%)
Alx1NP_001408403.1 Homeodomain 133..189 CDD:459649 39/55 (71%)
Transactivation domain. /evidence=ECO:0000250|UniProtKB:Q63087 192..326 26/128 (20%)
OAR 302..320 CDD:461067
OAR. /evidence=ECO:0000255|PROSITE-ProRule:PRU00138 306..319
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.