Sequence 1: | NP_611756.1 | Gene: | CG9876 / 37668 | FlyBaseID: | FBgn0034821 | Length: | 275 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_766141.1 | Gene: | Alx1 / 216285 | MGIID: | 104621 | Length: | 326 | Species: | Mus musculus |
Alignment Length: | 203 | Identity: | 71/203 - (34%) |
---|---|---|---|
Similarity: | 92/203 - (45%) | Gaps: | 78/203 - (38%) |
- Green bases have known domain annotations that are detailed below.
Fly 102 CSGNLPAGGGHHSRKPRRNRTTFSSAQLTALEKVFERTHYPDAFVREELATKVHLSEARVQVWFQ 166
Fly 167 NRRAKFRRNER-----------------SVGSRTLLDTAPQ-------------------LVPAP 195
Fly 196 ISNNMHKYANMPHPHPQPPPPPGAYALNFGPLELRSCQNYTNCYGGFGSSGASGSGV--CSFF-- 256
Fly 257 ----GATN 260 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG9876 | NP_611756.1 | Homeobox | 121..173 | CDD:278475 | 37/51 (73%) |
Alx1 | NP_766141.1 | Homeobox | 135..189 | CDD:395001 | 37/53 (70%) |
Transactivation domain. /evidence=ECO:0000250|UniProtKB:Q63087 | 192..326 | 26/128 (20%) | |||
OAR | 302..320 | CDD:397759 | |||
OAR. /evidence=ECO:0000255|PROSITE-ProRule:PRU00138 | 306..319 | ||||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | O | PTHR24329 |
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 2.010 |