| Sequence 1: | NP_611756.1 | Gene: | CG9876 / 37668 | FlyBaseID: | FBgn0034821 | Length: | 275 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_038693.1 | Gene: | Shox2 / 20429 | MGIID: | 1201673 | Length: | 331 | Species: | Mus musculus |
| Alignment Length: | 208 | Identity: | 63/208 - (30%) |
|---|---|---|---|
| Similarity: | 78/208 - (37%) | Gaps: | 87/208 - (41%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 87 GPTGAGCGGADRPAPCSGNLPAGGGHHSRKP--------------------------------RR 119
Fly 120 NRTTFSSAQLTALEKVFERTHYPDAFVREELATKVHLSEARVQVWFQNRRAKFRRNERSVGSRTL 184
Fly 185 LDTAPQLVPAPISNNMHKYAN-----MP---------------------------------HPH- 210
Fly 211 ---------PQPP 214 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG9876 | NP_611756.1 | Homeodomain | 118..174 | CDD:459649 | 37/55 (67%) |
| Shox2 | NP_038693.1 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..20 | ||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 26..140 | 11/61 (18%) | |||
| Homeodomain | 141..197 | CDD:459649 | 37/55 (67%) | ||
| OAR | 311..327 | CDD:461067 | |||
| OAR. /evidence=ECO:0000255|PROSITE-ProRule:PRU00138 | 313..326 | ||||
| Blue background indicates that the domain is not in the aligned region. | |||||