DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9876 and Shox2

DIOPT Version :10

Sequence 1:NP_611756.1 Gene:CG9876 / 37668 FlyBaseID:FBgn0034821 Length:275 Species:Drosophila melanogaster
Sequence 2:NP_038693.1 Gene:Shox2 / 20429 MGIID:1201673 Length:331 Species:Mus musculus


Alignment Length:208 Identity:63/208 - (30%)
Similarity:78/208 - (37%) Gaps:87/208 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly    87 GPTGAGCGGADRPAPCSGNLPAGGGHHSRKP--------------------------------RR 119
            |..|.|.||...|.   ..|..|....||:|                                ||
Mouse    81 GGAGGGAGGGRSPV---RELDMGAAERSREPGSPRLTEVSPELKDRKDDAKGMEDEGQTKIKQRR 142

  Fly   120 NRTTFSSAQLTALEKVFERTHYPDAFVREELATKVHLSEARVQVWFQNRRAKFRRNERSVGSRTL 184
            :||.|:..||..||::|:.|||||||:||||:.::.||||||||||||||||.|:.|..:....|
Mouse   143 SRTNFTLEQLNELERLFDETHYPDAFMREELSQRLGLSEARVQVWFQNRRAKCRKQENQLHKGVL 207

  Fly   185 LDTAPQLVPAPISNNMHKYAN-----MP---------------------------------HPH- 210
            :..|.|.....::    .|.|     ||                                 ||| 
Mouse   208 IGAASQFEACRVA----PYVNVGALRMPFQQDSHCNVTPLSFQVQAQLQLDSAVAHAHHHLHPHL 268

  Fly   211 ---------PQPP 214
                     |.||
Mouse   269 AAHAPYMMFPAPP 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9876NP_611756.1 Homeodomain 118..174 CDD:459649 37/55 (67%)
Shox2NP_038693.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..20
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 26..140 11/61 (18%)
Homeodomain 141..197 CDD:459649 37/55 (67%)
OAR 311..327 CDD:461067
OAR. /evidence=ECO:0000255|PROSITE-ProRule:PRU00138 313..326
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.