DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9876 and Prrx2

DIOPT Version :9

Sequence 1:NP_611756.1 Gene:CG9876 / 37668 FlyBaseID:FBgn0034821 Length:275 Species:Drosophila melanogaster
Sequence 2:XP_006497869.1 Gene:Prrx2 / 20204 MGIID:98218 Length:259 Species:Mus musculus


Alignment Length:195 Identity:84/195 - (43%)
Similarity:109/195 - (55%) Gaps:40/195 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 FSVDNIMEMKHDAYSKGKMAMELSSNFGPTGAGCGGADRP---------APCSGNLPA--GGGHH 113
            |||.::::::..|.:..:.|..:|   ||..|..|.|..|         ||..|:.|:  .|...
Mouse    33 FSVSHLLDLEEVAAAGRRAAGPVS---GPAEAREGAAREPSGGSSGSEAAPQDGDCPSPGRGTKR 94

  Fly   114 SRKPRRNRTTFSSAQLTALEKVFERTHYPDAFVREELATKVHLSEARV------------QVWFQ 166
            .:|.|||||||:|:||.|||:|||||||||||||||||.:|:||||||            |||||
Mouse    95 KKKQRRNRTTFNSSQLQALERVFERTHYPDAFVREELARRVNLSEARVQSTRPCSPHSPSQVWFQ 159

  Fly   167 NRRAKFRRNERSV---GSRTLLDTAPQ-------LVPAPISNNMHKYANMPHPHPQ---PPPPPG 218
            |||||||||||::   .|.:||.:..|       :.|.|.:.: ..|.:.|...|.   ||..||
Mouse   160 NRRAKFRRNERAMLATRSASLLKSYGQEAAIEQPVAPRPTTMS-PDYLSWPASSPYSSVPPYSPG 223

  Fly   219  218
            Mouse   224  223

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9876NP_611756.1 Homeobox 121..173 CDD:278475 44/63 (70%)
Prrx2XP_006497869.1 Homeobox 103..167 CDD:365835 44/63 (70%)
OAR 232..249 CDD:367680
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 105 1.000 Domainoid score I6649
eggNOG 1 0.900 - - E33208_3BKNX
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000011
OrthoInspector 1 1.000 - - otm43542
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X3194
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
87.770

Return to query results.
Submit another query.