DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9876 and EMX1

DIOPT Version :10

Sequence 1:NP_611756.1 Gene:CG9876 / 37668 FlyBaseID:FBgn0034821 Length:275 Species:Drosophila melanogaster
Sequence 2:NP_004088.2 Gene:EMX1 / 2016 HGNCID:3340 Length:290 Species:Homo sapiens


Alignment Length:78 Identity:35/78 - (44%)
Similarity:51/78 - (65%) Gaps:4/78 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   103 SGNLPAGG----GHHSRKPRRNRTTFSSAQLTALEKVFERTHYPDAFVREELATKVHLSEARVQV 163
            :.::|..|    |..:|||:|.||.||.:||..||:.||:.||.....|::||..:.|||.:|:|
Human   174 ASDVPQDGLLLHGPFARKPKRIRTAFSPSQLLRLERAFEKNHYVVGAERKQLAGSLSLSETQVKV 238

  Fly   164 WFQNRRAKFRRNE 176
            ||||||.|::|.:
Human   239 WFQNRRTKYKRQK 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9876NP_611756.1 Homeodomain 118..174 CDD:459649 28/55 (51%)
EMX1NP_004088.2 Homeodomain 193..249 CDD:459649 28/55 (51%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 249..290 1/3 (33%)

Return to query results.
Submit another query.