DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9876 and Rax

DIOPT Version :10

Sequence 1:NP_611756.1 Gene:CG9876 / 37668 FlyBaseID:FBgn0034821 Length:275 Species:Drosophila melanogaster
Sequence 2:NP_038861.2 Gene:Rax / 19434 MGIID:109632 Length:342 Species:Mus musculus


Alignment Length:159 Identity:68/159 - (42%)
Similarity:82/159 - (51%) Gaps:27/159 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    95 GADRPAPCSGNLPAGGGHH-------SRKPRRNRTTFSSAQLTALEKVFERTHYPDAFVREELAT 152
            |..||:|.....||.|...       .:|.|||||||::.||..||:.||::||||.:.|||||.
Mouse   107 GEARPSPGLSVGPAAGDSKLSEEEPPKKKHRRNRTTFTTYQLHELERAFEKSHYPDVYSREELAG 171

  Fly   153 KVHLSEARVQVWFQNRRAKFRRNER-SVGSRTLLD--------TAPQLVPAPISNNMHKYANMP- 207
            ||:|.|.||||||||||||:||.|: .|.|..|.|        :.|....||:.......:..| 
Mouse   172 KVNLPEVRVQVWFQNRRAKWRRQEKLEVSSMKLQDSPLLSFSRSPPSSALAPLGTGPGSGSGPPG 236

  Fly   208 -----HPHPQPP-PPPGAYAL----NFGP 226
                 .|...|| |..||.||    .|||
Mouse   237 SALPLEPWLGPPLPGGGATALQSLPGFGP 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9876NP_611756.1 Homeodomain 118..174 CDD:459649 38/55 (69%)
RaxNP_038861.2 Octapeptide motif 33..40
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 44..140 10/32 (31%)
Homeodomain 137..193 CDD:459649 38/55 (69%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 208..295 15/58 (26%)
OAR 316..331 CDD:461067
OAR. /evidence=ECO:0000255|PROSITE-ProRule:PRU00138 319..332
Nuclear localization signal. /evidence=ECO:0000255 325..329
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.