DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9876 and ceh-8

DIOPT Version :9

Sequence 1:NP_611756.1 Gene:CG9876 / 37668 FlyBaseID:FBgn0034821 Length:275 Species:Drosophila melanogaster
Sequence 2:NP_492246.2 Gene:ceh-8 / 191617 WormBaseID:WBGene00000433 Length:276 Species:Caenorhabditis elegans


Alignment Length:105 Identity:52/105 - (49%)
Similarity:61/105 - (58%) Gaps:18/105 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   115 RKPRRNRTTFSSAQLTALEKVFERTHYPDAFVREELATKVHLSEARVQVWFQNRRAKFRRNER-- 177
            :|.|||||||::.||.|||..|::|||||.:.||.||.||.|.|.|||||||||||||||.|:  
 Worm    58 KKQRRNRTTFTTFQLHALEAAFDKTHYPDVYARETLAAKVQLPEVRVQVWFQNRRAKFRRQEKQD 122

  Fly   178 ----------------SVGSRTLLDTAPQLVPAPISNNMH 201
                            |..|....||.|.|.||...::.|
 Worm   123 CQGEEKHSLKDTMPSWSWMSENKTDTPPMLPPANTLSSTH 162

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9876NP_611756.1 Homeobox 121..173 CDD:278475 35/51 (69%)
ceh-8NP_492246.2 Homeobox 64..116 CDD:278475 35/51 (69%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000011
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24329
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X3194
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.