DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9876 and Phox2b

DIOPT Version :10

Sequence 1:NP_611756.1 Gene:CG9876 / 37668 FlyBaseID:FBgn0034821 Length:275 Species:Drosophila melanogaster
Sequence 2:NP_032914.1 Gene:Phox2b / 18935 MGIID:1100882 Length:314 Species:Mus musculus


Alignment Length:215 Identity:77/215 - (35%)
Similarity:91/215 - (42%) Gaps:76/215 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    82 LSSNFGPTGAGCGGADRPAPCS-GNL-----------------PAGGGHHSRKPRRNRTTFSSAQ 128
            :.:.||.| :||... .|..|| |.|                 ..||.:..||.||.||||:|||
Mouse    47 IRTTFGAT-SGCPSL-TPGSCSLGTLRDHQSSPYAAVPYKLFTDHGGLNEKRKQRRIRTTFTSAQ 109

  Fly   129 LTALEKVFERTHYPDAFVREELATKVHLSEARVQVWFQNRRAKFRRNERSVG------------- 180
            |..||:||..|||||.:.|||||.|:.|:||||||||||||||||:.||:..             
Mouse   110 LKELERVFAETHYPDIYTREELALKIDLTEARVQVWFQNRRAKFRKQERAAAAAAAAAKNGSSGK 174

  Fly   181 ---------SRTLLDTAPQLVPAPISNNMHKYANMPHPHPQPPPPPGAYALNFGPLELRSCQNYT 236
                     |:....|.|.....            |.|:|.|.|..||                 
Mouse   175 KSDSSRDDESKEAKSTDPDSTGG------------PGPNPNPTPSCGA----------------- 210

  Fly   237 NCYGGFGSS-----GASGSG 251
            |..||.|.|     ||:|.|
Mouse   211 NGGGGGGPSPAGAPGAAGPG 230

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9876NP_611756.1 Homeodomain 118..174 CDD:459649 41/55 (75%)
Phox2bNP_032914.1 Homeodomain 99..155 CDD:459649 41/55 (75%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 162..246 19/98 (19%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 259..289
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.