DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9876 and pax-3

DIOPT Version :10

Sequence 1:NP_611756.1 Gene:CG9876 / 37668 FlyBaseID:FBgn0034821 Length:275 Species:Drosophila melanogaster
Sequence 2:NP_496189.2 Gene:pax-3 / 185022 WormBaseID:WBGene00003939 Length:308 Species:Caenorhabditis elegans


Alignment Length:172 Identity:48/172 - (27%)
Similarity:74/172 - (43%) Gaps:43/172 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 FSVDNIMEMKHDAYSKGKMAMELSSNFGPTGAGCGGADRPAPCSGNLPAGGGHHSRKPRRNRTTF 124
            :|:|:|:.:..|..||.....|                     .|:.|:    :....|||||:|
 Worm   155 YSIDSILGISIDECSKSSSDDE---------------------EGSSPS----NDASSRRNRTSF 194

  Fly   125 SSAQLTALEKVFERTHYPDAFVREELATKVHLSEARVQVWFQNRRAKFRR--------NERSVGS 181
            ::.||..||..|....||.|..||.::.:..|||.::..||.||||:.|:        |.:..||
 Worm   195 TAEQLDVLENAFRADTYPHANARESISKETGLSEEKIMTWFSNRRARCRKNMPMYQQYNVQGFGS 259

  Fly   182 RTLLDTAPQLVPAPISNNMHKYANMPHPHP-------QPPPP 216
            ..  .:.|.|:|:|:. .:..|:..|..:|       |..||
 Worm   260 SP--PSYPTLLPSPMM-FLPSYSTSPQLNPLFFQHILQSSPP 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9876NP_611756.1 Homeodomain 118..174 CDD:459649 25/55 (45%)
pax-3NP_496189.2 PAX 13..141 CDD:238076
Homeodomain 188..244 CDD:459649 25/55 (45%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.