DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9876 and Otx2

DIOPT Version :10

Sequence 1:NP_611756.1 Gene:CG9876 / 37668 FlyBaseID:FBgn0034821 Length:275 Species:Drosophila melanogaster
Sequence 2:NP_001273410.1 Gene:Otx2 / 18424 MGIID:97451 Length:297 Species:Mus musculus


Alignment Length:190 Identity:66/190 - (34%)
Similarity:85/190 - (44%) Gaps:52/190 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   100 APCSGNLPAGGGHHSRKPRRNRTTFSSAQLTALEKVFERTHYPDAFVREELATKVHLSEARVQVW 164
            |.|....|       ||.||.||||:.|||..||.:|.:|.|||.|:|||:|.|::|.|:|||||
Mouse    36 ASCPAATP-------RKQRRERTTFTRAQLDVLEALFAKTRYPDIFMREEVALKINLPESRVQVW 93

  Fly   165 FQNRRAKFRRNE---------------------RSVGSRTLLDTAPQLVPAPISNNMHKYANMPH 208
            |:|||||.|:.:                     |.|.|.:  .|:.|..| |.|.::...|:...
Mouse    94 FKNRRAKCRQQQQQQQNGGQNKVRPAKKKSSPAREVSSES--GTSGQFSP-PSSTSVPTIASSSA 155

  Fly   209 PHPQPPPPPGAYALNFGPLE-----LRSC------QNYTNCYGGFGSSGASGSGVCSFFG 257
            |.....|      .:..||.     ..||      ..||...|  .|.|.:||  .|:||
Mouse   156 PVSIWSP------ASISPLSDPLSTSSSCMQRSYPMTYTQASG--YSQGYAGS--TSYFG 205

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9876NP_611756.1 Homeodomain 118..174 CDD:459649 35/55 (64%)
Otx2NP_001273410.1 Homeodomain 47..102 CDD:459649 35/54 (65%)
TF_Otx 161..242 CDD:427350 15/55 (27%)

Return to query results.
Submit another query.