DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9876 and dsc-1

DIOPT Version :9

Sequence 1:NP_611756.1 Gene:CG9876 / 37668 FlyBaseID:FBgn0034821 Length:275 Species:Drosophila melanogaster
Sequence 2:NP_510497.1 Gene:dsc-1 / 181599 WormBaseID:WBGene00001096 Length:310 Species:Caenorhabditis elegans


Alignment Length:239 Identity:64/239 - (26%)
Similarity:96/239 - (40%) Gaps:42/239 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 HSLPVGNPGNFYYG----------PTVSGEIYSSHQSHNLESEDKLEDREESGRNLDKIHRFS-- 61
            |:|.|....:|...          ||....|.|:|::..|   .:|...:..| |.|. |.||  
 Worm    75 HNLGVALHNHFQMSNQHYLSDFDCPTTVSPISSAHETGQL---PQLSPYDHIG-NQDP-HMFSPH 134

  Fly    62 -VDNIMEMKHDAYSKGKMAMELSSNFGPT--GAGCGGADRPAPCSGNLPAGGGHHSRKPRRNRTT 123
             ..|.| :..::|.:.......:.|.|.:  ......:|....|.|.            ||.||.
 Worm   135 AYGNSM-IPDNSYFENASRSISAPNVGNSTLNPSLMSSDNAQSCGGR------------RRFRTN 186

  Fly   124 FSSAQLTALEKVFERTHYPDAFVREELATKVHLSEARVQVWFQNRRAKFRRNERSVGSRTLLDTA 188
            |:..|.|.||..|:.:||||...::.:|..:.:.|.|:.|||||||||:||.|.....||..::.
 Worm   187 FTELQSTFLEDSFKESHYPDHKAKKYMADFLKIPEDRITVWFQNRRAKWRRKEHRQRDRTRNESF 251

  Fly   189 PQLVPAPISNNMHKYANMPHPHPQPPP---PPGAYALNFGPLEL 229
            ..      .:|...:|.....||...|   .|.::.:...|:.|
 Worm   252 SG------GSNSFDFACFSAQHPDDGPNAKHPNSFGIPNQPMSL 289

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9876NP_611756.1 Homeobox 121..173 CDD:278475 24/51 (47%)
dsc-1NP_510497.1 Homeobox 184..236 CDD:278475 24/51 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24329
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.