DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9876 and alr-1

DIOPT Version :9

Sequence 1:NP_611756.1 Gene:CG9876 / 37668 FlyBaseID:FBgn0034821 Length:275 Species:Drosophila melanogaster
Sequence 2:NP_509860.1 Gene:alr-1 / 181302 WormBaseID:WBGene00044330 Length:362 Species:Caenorhabditis elegans


Alignment Length:216 Identity:79/216 - (36%)
Similarity:97/216 - (44%) Gaps:64/216 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 LESEDKLEDREESGRNLDKIHR-----------------------------------FSV----D 63
            |:.||..:|.::...|...:||                                   ||:    :
 Worm     4 LKKEDSSKDEKDLDMNCPPLHRPNGADLNQYSKSLMEQLQAQLFANPALQFPSFPPAFSIAALTN 68

  Fly    64 NIMEMKHDAYSKGKMAMELSSNFGPTG-------AGCGGADRPAPCSG-NLPAGGGHHSRKPRRN 120
            |..|:|.|   .||..        |||       :.....:..:|..| |.|...|  .||.||.
 Worm    69 NQHELKED---DGKKT--------PTGDNILEAASVLDNRENGSPSDGTNSPDDNG--KRKQRRY 120

  Fly   121 RTTFSSAQLTALEKVFERTHYPDAFVREELATKVHLSEARVQVWFQNRRAKFRRNERSVGSRTLL 185
            |||||:.||..|||||.||||||.|.||||||:|.|:||||||||||||||:|:.|||...... 
 Worm   121 RTTFSAFQLDELEKVFARTHYPDVFTREELATRVQLTEARVQVWFQNRRAKYRKQERSSTHHPY- 184

  Fly   186 DTAPQLVPAPISNNMHKYANM 206
             .||..:|.  ||..:.|..|
 Worm   185 -QAPMSIPN--SNGDNPYQMM 202

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9876NP_611756.1 Homeobox 121..173 CDD:278475 41/51 (80%)
alr-1NP_509860.1 Homeobox 121..174 CDD:365835 41/52 (79%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000011
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24329
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
54.970

Return to query results.
Submit another query.