DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9876 and Meox2

DIOPT Version :10

Sequence 1:NP_611756.1 Gene:CG9876 / 37668 FlyBaseID:FBgn0034821 Length:275 Species:Drosophila melanogaster
Sequence 2:NP_032610.1 Gene:Meox2 / 17286 MGIID:103219 Length:303 Species:Mus musculus


Alignment Length:176 Identity:51/176 - (28%)
Similarity:71/176 - (40%) Gaps:51/176 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    83 SSNFG---PTGAGCGGAD--RPA--PCSGNLPAG------------GGHHSR---KPRRNRTTFS 125
            ||:.|   ||||.|...|  |.|  |......:|            |.:.|.   |||:.||.|:
Mouse   130 SSSLGSSTPTGAACAPGDYGRQALSPADVEKRSGSKRKSDSSDSQEGNYKSEVNSKPRKERTAFT 194

  Fly   126 SAQLTALEKVFERTHYPDAFVREELATKVHLSEARVQVWFQNRRAKFRR---------------- 174
            ..|:..||..|...:|.....|.|:|..:.|:|.:|:|||||||.|::|                
Mouse   195 KEQIRELEAEFAHHNYLTRLRRYEIAVNLDLTERQVKVWFQNRRMKWKRVKGGQQGAAAREKELV 259

  Fly   175 ---------NERS-VGSRTLLDTAPQLVPAPISNNMHKYANMPHPH 210
                     :|.| :|:.||..|...|......::.|   :..|.|
Mouse   260 NVKKGTLLPSELSGIGAATLQQTGDSLANEDSRDSDH---SSEHAH 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9876NP_611756.1 Homeodomain 118..174 CDD:459649 23/55 (42%)
Meox2NP_032610.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 63..191 18/60 (30%)
Homeodomain 187..243 CDD:459649 23/55 (42%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 278..303 7/28 (25%)

Return to query results.
Submit another query.