DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9876 and ARX

DIOPT Version :9

Sequence 1:NP_611756.1 Gene:CG9876 / 37668 FlyBaseID:FBgn0034821 Length:275 Species:Drosophila melanogaster
Sequence 2:NP_620689.1 Gene:ARX / 170302 HGNCID:18060 Length:562 Species:Homo sapiens


Alignment Length:297 Identity:88/297 - (29%)
Similarity:121/297 - (40%) Gaps:89/297 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 GNPGNFYYGPTVSGEIYSSHQSHNLESEDKLEDREESGRNLDKIHRFSVDNIMEMKHDAYSKGKM 78
            |.||:   .|...|...:......|..:::.||.||.....|:      :.::|....|..|...
Human   209 GGPGS---APAAGGGTGTEDDEEELLEDEEDEDEEEELLEDDE------EELLEDDARALLKEPR 264

  Fly    79 AMELSSNFGPTGAGCGGADRPAPCSGN-------------------------LPAGG----GHHS 114
            ...:::    |||....|.......|.                         |.||.    |...
Human   265 RCPVAA----TGAVAAAAAAAVATEGGELSPKEELLLHPEDAEGKDGEDSVCLSAGSDSEEGLLK 325

  Fly   115 RKPRRNRTTFSSAQLTALEKVFERTHYPDAFVREELATKVHLSEARVQVWFQNRRAKFRRNERSV 179
            ||.||.||||:|.||..||:.|::|||||.|.|||||.::.|:||||||||||||||:|:.|:: 
Human   326 RKQRRYRTTFTSYQLEELERAFQKTHYPDVFTREELAMRLDLTEARVQVWFQNRRAKWRKREKA- 389

  Fly   180 GSRTLLDTAPQLVPAPIS--NNMHKYANM----PH-----------------PHPQPPPPPGAYA 221
            |::|.....|  .|.|:|  :.:..|.:.    ||                 ..|..|||||:.:
Human   390 GAQTHPPGLP--FPGPLSATHPLSPYLDASPFPPHHPALDSAWTAAAAAAAAAFPSLPPPPGSAS 452

  Fly   222 LNFGPLELRSCQNYTNCYGGFGSSGASGSGVCSFFGA 258
            |                    ..|||. .|:.:|.||
Human   453 L--------------------PPSGAP-LGLSTFLGA 468

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9876NP_611756.1 Homeobox 121..173 CDD:278475 36/51 (71%)
ARXNP_620689.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..21
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 50..81
GCG-encoded polyalanine repeat 102..111
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 118..255 12/54 (22%)
Homeobox 332..385 CDD:395001 36/52 (69%)
OAR 526..544 CDD:397759
OAR. /evidence=ECO:0000255|PROSITE-ProRule:PRU00138 530..543
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24329
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.