DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9876 and Lmx1b

DIOPT Version :9

Sequence 1:NP_611756.1 Gene:CG9876 / 37668 FlyBaseID:FBgn0034821 Length:275 Species:Drosophila melanogaster
Sequence 2:XP_006497809.1 Gene:Lmx1b / 16917 MGIID:1100513 Length:408 Species:Mus musculus


Alignment Length:215 Identity:54/215 - (25%)
Similarity:85/215 - (39%) Gaps:43/215 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 YSKGKMAMELSSNFGPTGAGC------GGADRPAPCSGNLPAGGGHHS---RKPRRNRTTFSSAQ 128
            |.|.|   :|.|:..|..:..      .|..:||...|:...|.|...   |:|:|.||..::.|
Mouse   175 YEKEK---DLLSSVSPDESDSVKSEDEDGDMKPAKGQGSQSKGSGDDGKDPRRPKRPRTILTTQQ 236

  Fly   129 LTALEKVFERTHYPDAFVREELATKVHLSEARVQVWFQNRRAKF----RRNERSVGSRTLLDTAP 189
            ..|.:..||.:..|...|||.||.:..||...|||||||:|||.    ||:::....:.......
Mouse   237 RRAFKASFEVSSKPCRKVRETLAAETGLSVRVVQVWFQNQRAKMKKLARRHQQQQEQQNSQRLGQ 301

  Fly   190 QLVPAPISNNMHKYANMPHPHPQ--------------------PPPPPGAYALNFGPLEL----- 229
            :::.:.:...|..|..:..|..|                    ||..||.:...:|...:     
Mouse   302 EVLSSRMEGMMASYTPLAPPQQQIVAMEQSPYGSSDPFQQGLTPPQMPGDHMNPYGNDSIFHDID 366

  Fly   230 --RSCQNYTNCYGGFGSSGA 247
              .|..:.::|:.|....|:
Mouse   367 SDTSLTSLSDCFLGSSDVGS 386

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9876NP_611756.1 Homeobox 121..173 CDD:278475 24/55 (44%)
Lmx1bXP_006497809.1 LIM1_Lmx1b 62..114 CDD:188757
LIM2_Lmx1a_Lmx1b 121..175 CDD:188764 54/215 (25%)
Homeobox 228..282 CDD:365835 24/53 (45%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.