DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9876 and RHOXF1

DIOPT Version :9

Sequence 1:NP_611756.1 Gene:CG9876 / 37668 FlyBaseID:FBgn0034821 Length:275 Species:Drosophila melanogaster
Sequence 2:XP_011529583.1 Gene:RHOXF1 / 158800 HGNCID:29993 Length:212 Species:Homo sapiens


Alignment Length:132 Identity:43/132 - (32%)
Similarity:62/132 - (46%) Gaps:32/132 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 GKMAMELSSNFGPTGAGC---GGADRPAPCSGNLPAGGGHH------------------------ 113
            |:.|..|..|..|.| |.   .|.:|.   .|.:|.|||.:                        
Human    66 GQGAPGLMGNMNPEG-GVNHENGMNRD---GGMIPEGGGGNQEPRQQPQPPPEEPAQAAMEGPQP 126

  Fly   114 -SRKPRRNRTTFSSAQLTALEKVFERTHYPDAFVREELATKVHLSEARVQVWFQNRRAKFRRNER 177
             :.:||..||.|:..|:..||.||..|.|||...|.|||..:.::|.:|:|||:|:||:.||::|
Human   127 ENMQPRTRRTKFTLLQVEELESVFRHTQYPDVPTRRELAENLGVTEDKVRVWFKNKRARCRRHQR 191

  Fly   178 SV 179
            .:
Human   192 EL 193

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9876NP_611756.1 Homeobox 121..173 CDD:278475 24/51 (47%)
RHOXF1XP_011529583.1 homeodomain 132..190 CDD:238039 27/57 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000011
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.