DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9876 and Hoxd4

DIOPT Version :10

Sequence 1:NP_611756.1 Gene:CG9876 / 37668 FlyBaseID:FBgn0034821 Length:275 Species:Drosophila melanogaster
Sequence 2:NP_034599.2 Gene:Hoxd4 / 15436 MGIID:96208 Length:250 Species:Mus musculus


Alignment Length:163 Identity:42/163 - (25%)
Similarity:65/163 - (39%) Gaps:50/163 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    84 SNFGPTGAGCGGADRPAPCSG----NLPAG---------------------------------GG 111
            |::|..|..| .|..|||..|    :.|.|                                 ||
Mouse    87 SHYGAPGERC-PAPPPAPLPGARACSQPTGPKQPPPGTALKQPAVVYPWMKKVHVNSVNPNYTGG 150

  Fly   112 HHSRKPRRNRTTFSSAQLTALEKVFERTHYPDAFVREELATKVHLSEARVQVWFQNRRAKFRRNE 176
                :|:|:||.::..|:..|||.|....|.....|.|:|..:.|||.::::||||||.|::::.
Mouse   151 ----EPKRSRTAYTRQQVLELEKEFHFNRYLTRRRRIEIAHTLCLSERQIKIWFQNRRMKWKKDH 211

  Fly   177 R--------SVGSRTLLDTAPQLVPAPISNNMH 201
            :        |..|......||.....|::.:.|
Mouse   212 KLPNTKGRSSSSSSCSSSAAPGQHLQPMAKDHH 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9876NP_611756.1 Homeodomain 118..174 CDD:459649 22/55 (40%)
Hoxd4NP_034599.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 31..126 11/39 (28%)
Antp-type hexapeptide 131..136 0/4 (0%)
Homeodomain 153..209 CDD:459649 22/55 (40%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 210..250 6/35 (17%)

Return to query results.
Submit another query.