DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9876 and Hoxb7

DIOPT Version :10

Sequence 1:NP_611756.1 Gene:CG9876 / 37668 FlyBaseID:FBgn0034821 Length:275 Species:Drosophila melanogaster
Sequence 2:NP_034590.2 Gene:Hoxb7 / 15415 MGIID:96188 Length:217 Species:Mus musculus


Alignment Length:66 Identity:23/66 - (34%)
Similarity:38/66 - (57%) Gaps:0/66 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   118 RRNRTTFSSAQLTALEKVFERTHYPDAFVREELATKVHLSEARVQVWFQNRRAKFRRNERSVGSR 182
            :|.|.|::..|...|||.|....|.....|.|:|..:.|:|.::::||||||.|:::..::.|..
Mouse   138 KRGRQTYTRYQTLELEKEFHYNRYLTRRRRIEIAHTLCLTERQIKIWFQNRRMKWKKENKTSGPG 202

  Fly   183 T 183
            |
Mouse   203 T 203

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9876NP_611756.1 Homeodomain 118..174 CDD:459649 21/55 (38%)
Hoxb7NP_034590.2 Antp-type hexapeptide 126..131
Homeodomain 138..194 CDD:459649 21/55 (38%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 192..217 2/12 (17%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.