DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9876 and Hoxa6

DIOPT Version :10

Sequence 1:NP_611756.1 Gene:CG9876 / 37668 FlyBaseID:FBgn0034821 Length:275 Species:Drosophila melanogaster
Sequence 2:NP_034584.1 Gene:Hoxa6 / 15403 MGIID:96178 Length:232 Species:Mus musculus


Alignment Length:183 Identity:50/183 - (27%)
Similarity:78/183 - (42%) Gaps:26/183 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 YQQQLHSLPVGNPGNFYYGPTVSGEIYSSHQSHNLESEDKLEDREESGRNL-----DKIHRFSVD 63
            :.||.:|:...|..::.||.:.            ..|:..|.....||.|.     |.:| ||.:
Mouse    57 FYQQSNSVLACNRASYEYGASC------------FYSDKDLSGASPSGNNKQRGPGDYLH-FSPE 108

  Fly    64 NIMEMKHDAYSKGKMAMELSSNFGPTGAGCGGADRPAPCSGNLPAGGGHHSRKPRRNRTTFSSAQ 128
              .:.|.|...:||...|..::...|........|...|:|   |..|.|.   ||.|.|::..|
Mouse   109 --QQYKPDGSVQGKALHEEGTDRKYTSPVYPWMQRMNSCAG---AVYGSHG---RRGRQTYTRYQ 165

  Fly   129 LTALEKVFERTHYPDAFVREELATKVHLSEARVQVWFQNRRAKFRRNERSVGS 181
            ...|||.|....|.....|.|:|..:.|:|.::::||||||.|:::..:.:.|
Mouse   166 TLELEKEFHFNRYLTRRRRIEIANALCLTERQIKIWFQNRRMKWKKENKLINS 218

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9876NP_611756.1 Homeodomain 118..174 CDD:459649 22/55 (40%)
Hoxa6NP_034584.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 88..126 12/40 (30%)
Antp-type hexapeptide 135..140 0/4 (0%)
Homeodomain 155..211 CDD:459649 22/55 (40%)

Return to query results.
Submit another query.