DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9876 and Hoxa4

DIOPT Version :10

Sequence 1:NP_611756.1 Gene:CG9876 / 37668 FlyBaseID:FBgn0034821 Length:275 Species:Drosophila melanogaster
Sequence 2:NP_032291.1 Gene:Hoxa4 / 15401 MGIID:96176 Length:285 Species:Mus musculus


Alignment Length:154 Identity:44/154 - (28%)
Similarity:67/154 - (43%) Gaps:28/154 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    87 GPT--GAGCGG---------ADR-PAPCSGNLP-------------AGGGHHSRKPRRNRTTFSS 126
            |||  ....||         ||: ||...|..|             ....::..:|:|:||.::.
Mouse   125 GPTTPAVATGGSAPACPLLLADQGPAGPKGKEPVVYPWMKKIHVSAVNSSYNGGEPKRSRTAYTR 189

  Fly   127 AQLTALEKVFERTHYPDAFVREELATKVHLSEARVQVWFQNRRAKFRRNERSVGSRTLLDTAPQL 191
            .|:..|||.|....|.....|.|:|..:.|||.:|::||||||.|::::.:...::.   .:...
Mouse   190 QQVLELEKEFHFNRYLTRRRRIEIAHTLCLSERQVKIWFQNRRMKWKKDHKLPNTKM---RSSNT 251

  Fly   192 VPAPISNNMHKYANMPHPHPQPPP 215
            ..||.........:.|||||.|.|
Mouse   252 ASAPAGPPGKAQTHSPHPHPHPLP 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9876NP_611756.1 Homeodomain 118..174 CDD:459649 23/55 (42%)
Hoxa4NP_032291.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 19..70
PHA03247 <43..161 CDD:223021 11/35 (31%)
Antp-type hexapeptide 159..164 0/4 (0%)
Homeodomain 181..237 CDD:459649 23/55 (42%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 238..285 9/41 (22%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.