DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9876 and Hoxa3

DIOPT Version :10

Sequence 1:NP_611756.1 Gene:CG9876 / 37668 FlyBaseID:FBgn0034821 Length:275 Species:Drosophila melanogaster
Sequence 2:NP_034582.1 Gene:Hoxa3 / 15400 MGIID:96175 Length:443 Species:Mus musculus


Alignment Length:191 Identity:61/191 - (31%)
Similarity:86/191 - (45%) Gaps:40/191 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    89 TGAGCGGADRPAPCSGNLPAGGGHHSRKPRRNRTTFSSAQLTALEKVFERTHYPDAFVREELATK 153
            :|..|.| |:..|         |..|.|  |.||.::||||..|||.|....|.....|.|:|..
Mouse   176 SGESCAG-DKSPP---------GQASSK--RARTAYTSAQLVELEKEFHFNRYLCRPRRVEMANL 228

  Fly   154 VHLSEARVQVWFQNRRAKFRRNERSVGSRTLL-DTAPQLVPAP-----ISNNMHKYAN-MPHPHP 211
            ::|:|.::::||||||.|::::::..|..|.. ..:|...|.|     ..|:||...| :|:...
Mouse   229 LNLTERQIKIWFQNRRMKYKKDQKGKGMLTSSGGQSPSRSPVPPGAGGYLNSMHSLVNSVPYEPQ 293

  Fly   212 QPP----PPPGAYALNFG--PLELRSC-------QNYTNCYGGFGSS--------GASGSG 251
            .||    ||.|||.|...  |..|.||       :.||....|.|.:        |..|:|
Mouse   294 SPPPFSKPPQGAYGLPPASYPAPLPSCAPPPPPQKRYTAAGSGAGGTPDYDPHAHGLQGNG 354

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9876NP_611756.1 Homeodomain 118..174 CDD:459649 24/55 (44%)
Hoxa3NP_034582.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 74..151
Antp-type hexapeptide 156..161
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 163..197 9/32 (28%)
COG5576 <182..309 CDD:227863 47/138 (34%)
Homeodomain 193..249 CDD:459649 25/57 (44%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 248..354 28/105 (27%)
DUF4074 378..441 CDD:463833
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 401..443
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.