DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9876 and Gsc

DIOPT Version :10

Sequence 1:NP_611756.1 Gene:CG9876 / 37668 FlyBaseID:FBgn0034821 Length:275 Species:Drosophila melanogaster
Sequence 2:NP_034481.1 Gene:Gsc / 14836 MGIID:95841 Length:256 Species:Mus musculus


Alignment Length:51 Identity:12/51 - (23%)
Similarity:22/51 - (43%) Gaps:9/51 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   126 KPG-------NCGGFINSNFTIFLTDRQGVPVERLNAGIHPYTLEDMVENL 169
            |||       ..||:|.|.::..:....|  :.:.:.|......:|:|.|:
Mouse    89 KPGPPGPPGPGPGGYIPSFYSPKIAFYAG--LRKQHEGTEVLKFDDVVTNV 137

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9876NP_611756.1 Homeodomain 118..174 CDD:459649 12/51 (24%)
GscNP_034481.1 Homeodomain 161..217 CDD:459649
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 213..256
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.