DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9876 and dmbx1a

DIOPT Version :10

Sequence 1:NP_611756.1 Gene:CG9876 / 37668 FlyBaseID:FBgn0034821 Length:275 Species:Drosophila melanogaster
Sequence 2:NP_835457.2 Gene:dmbx1a / 142987 ZFINID:ZDB-GENE-020117-1 Length:383 Species:Danio rerio


Alignment Length:121 Identity:50/121 - (41%)
Similarity:72/121 - (59%) Gaps:2/121 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 NIMEMKHDAYSKGKMAMELSSNFGPTGAGCGGADRPAPCSGNLPAGGGHHSRKPRRNRTTFSSAQ 128
            |.:...::.:.:.....:.:.::.|:......|:|.|...  |.|..|...||.||:||.|::.|
Zfish    15 NSLSAMYNLHQQAAQQAQHAPDYRPSVHALTLAERLADII--LEARYGSQHRKQRRSRTAFTAQQ 77

  Fly   129 LTALEKVFERTHYPDAFVREELATKVHLSEARVQVWFQNRRAKFRRNERSVGSRTL 184
            |.||||.|::|||||..:||.||...:|.||||||||:|||||||:.:||:....|
Zfish    78 LEALEKTFQKTHYPDVVMRERLAMCTNLPEARVQVWFKNRRAKFRKKQRSLQKEQL 133

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9876NP_611756.1 Homeodomain 118..174 CDD:459649 36/55 (65%)
dmbx1aNP_835457.2 Homeodomain 67..123 CDD:459649 36/55 (65%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 124..267 3/10 (30%)
OAR. /evidence=ECO:0000255|PROSITE-ProRule:PRU00138 360..373
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.