DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9876 and Emx2

DIOPT Version :10

Sequence 1:NP_611756.1 Gene:CG9876 / 37668 FlyBaseID:FBgn0034821 Length:275 Species:Drosophila melanogaster
Sequence 2:NP_034262.2 Gene:Emx2 / 13797 MGIID:95388 Length:253 Species:Mus musculus


Alignment Length:63 Identity:32/63 - (50%)
Similarity:44/63 - (69%) Gaps:0/63 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   114 SRKPRRNRTTFSSAQLTALEKVFERTHYPDAFVREELATKVHLSEARVQVWFQNRRAKFRRNE 176
            :|||:|.||.||.:||..||..||:.||.....|::||..:.|:|.:|:|||||||.||:|.:
Mouse   152 ARKPKRIRTAFSPSQLLRLEHAFEKNHYVVGAERKQLAHSLSLTETQVKVWFQNRRTKFKRQK 214

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9876NP_611756.1 Homeodomain 118..174 CDD:459649 28/55 (51%)
Emx2NP_034262.2 Homeodomain 156..212 CDD:459649 28/55 (51%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 213..253 0/2 (0%)

Return to query results.
Submit another query.