DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9876 and Dlx6

DIOPT Version :10

Sequence 1:NP_611756.1 Gene:CG9876 / 37668 FlyBaseID:FBgn0034821 Length:275 Species:Drosophila melanogaster
Sequence 2:NP_034187.1 Gene:Dlx6 / 13396 MGIID:101927 Length:297 Species:Mus musculus


Alignment Length:235 Identity:56/235 - (23%)
Similarity:86/235 - (36%) Gaps:70/235 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 NYQQQLHSLP-VGNPGNFYYGPTVSGEIYSSHQSHNLESEDKLEDREESGRNLDKIHRFSV---- 62
            ::|...|..| ..:.||.|...:::...|.||..|:              ..|...|..|.    
Mouse    94 HHQHHHHGSPYASSGGNSYNHRSLAAYPYMSHSQHS--------------PYLQSYHNSSAAAQT 144

  Fly    63 --DNIMEMKHDAYSKGKMAMELSSNFGPTGAGCGGADRPAPCSGNLPAGGGHHSRKPRRNRTTFS 125
              |:..:.|......|::...                           |.|...|||   ||.:|
Mouse   145 RGDDTDQQKTTVIENGEIRFN---------------------------GKGKKIRKP---RTIYS 179

  Fly   126 SAQLTALEKVFERTHYPDAFVREELATKVHLSEARVQVWFQNRRAKFRR----------NERSVG 180
            |.||.||...|::|.|.....|.|||..:.|::.:|::||||:|:||::          ::...|
Mouse   180 SLQLQALNHRFQQTQYLALPERAELAASLGLTQTQVKIWFQNKRSKFKKLLKQGSNPHESDPLPG 244

  Fly   181 SRTLLDTAPQLVPAPISNNMHKYANMPHPHPQPPPPPGAY 220
            |..|...:|.|.|....:...|..:|         ||.:|
Mouse   245 SAALSPRSPALPPVWDVSASAKGVSM---------PPNSY 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9876NP_611756.1 Homeodomain 118..174 CDD:459649 24/55 (44%)
Dlx6NP_034187.1 COG5576 123..279 CDD:227863 49/206 (24%)
Homeodomain 172..228 CDD:459649 27/58 (47%)

Return to query results.
Submit another query.