DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9876 and Dlx5

DIOPT Version :10

Sequence 1:NP_611756.1 Gene:CG9876 / 37668 FlyBaseID:FBgn0034821 Length:275 Species:Drosophila melanogaster
Sequence 2:NP_034186.2 Gene:Dlx5 / 13395 MGIID:101926 Length:289 Species:Mus musculus


Alignment Length:186 Identity:49/186 - (26%)
Similarity:75/186 - (40%) Gaps:53/186 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    94 GGADRPAPCSGNLP-----------AGGGHHSRKPRRNRTTFSSAQLTALEKVFERTHYPDAFVR 147
            |||....|.:.:.|           ..|  ..:|.|:.||.:||.||.||::.|::|.|.....|
Mouse   105 GGAYNRVPSATSQPEKEVAEPEVRMVNG--KPKKVRKPRTIYSSFQLAALQRRFQKTQYLALPER 167

  Fly   148 EELATKVHLSEARVQVWFQNRRAKFR---RNERSVGSRTLLDTAPQLVPAPIS-------NNMHK 202
            .|||..:.|::.:|::||||:|:|.:   :|.......:...:.|....:|.|       .:...
Mouse   168 AELAASLGLTQTQVKIWFQNKRSKIKKIMKNGEMPPEHSPSSSDPMACNSPQSPAVWEPQGSSRS 232

  Fly   203 YANMPHPHP----QPP-----------------------PPPGAYALNFGPLELRS 231
            .::.||.||    |.|                       ||||:..   .||.|.|
Mouse   233 LSHHPHAHPPTSNQSPASSYLENSASWYPSAASSINSHLPPPGSLQ---HPLALAS 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9876NP_611756.1 Homeodomain 118..174 CDD:459649 24/58 (41%)
Dlx5NP_034186.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..49
DLL_N 32..118 CDD:463567 4/12 (33%)
Homeodomain 138..194 CDD:459649 24/55 (44%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 198..253 10/54 (19%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 270..289 8/19 (42%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.