DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9876 and Dlx1

DIOPT Version :10

Sequence 1:NP_611756.1 Gene:CG9876 / 37668 FlyBaseID:FBgn0034821 Length:275 Species:Drosophila melanogaster
Sequence 2:NP_034183.1 Gene:Dlx1 / 13390 MGIID:94901 Length:255 Species:Mus musculus


Alignment Length:167 Identity:51/167 - (30%)
Similarity:78/167 - (46%) Gaps:35/167 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   109 GGGHHSRKPRRNRTTFSSAQLTALEKVFERTHYPDAFVREELATKVHLSEARVQVWFQNRRAKFR 173
            |.|...|||   ||.:||.||.||.:.|::|.|.....|.|||..:.|::.:|::||||:|:||:
Mouse   123 GKGKKIRKP---RTIYSSLQLQALNRRFQQTQYLALPERAELAASLGLTQTQVKIWFQNKRSKFK 184

  Fly   174 RNERSVGSRTLLDTAPQLVPAPISNNMHKYANMPHPHPQPPPPPGAYALNFGPLELRSCQNYTNC 238
            :..:..|:        .|..:.::|.....|.      .||.|||     :.|          |.
Mouse   185 KLMKQGGA--------ALEGSALANGRALSAG------SPPVPPG-----WNP----------NS 220

  Fly   239 YGGFGSSGASGSGVCSFFGATNYCVAANYAKNAYPPL 275
            ..|.||..::||.|.|:   |::..:|:......|.|
Mouse   221 SSGKGSGSSAGSYVPSY---TSWYPSAHQEAMQQPQL 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9876NP_611756.1 Homeodomain 118..174 CDD:459649 24/55 (44%)
Dlx1NP_034183.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..38
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 95..118
Homeodomain 129..185 CDD:459649 27/58 (47%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 204..233 12/49 (24%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.