DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9876 and Dbx1

DIOPT Version :10

Sequence 1:NP_611756.1 Gene:CG9876 / 37668 FlyBaseID:FBgn0034821 Length:275 Species:Drosophila melanogaster
Sequence 2:NP_001005232.1 Gene:Dbx1 / 13172 MGIID:94867 Length:335 Species:Mus musculus


Alignment Length:179 Identity:55/179 - (30%)
Similarity:78/179 - (43%) Gaps:46/179 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 YSKGKMAMELSSNFGPTGAGCGGADRPAPCSGNLPAGGGHHSRKPRR---NRTTFSSAQLTALEK 134
            |.:|.....:.|::.|  |.......|...|..|.|.|     ||||   .|..||..|..||||
Mouse   141 YFEGSFQPFIRSSYFP--ASSSVVPIPGTFSWPLAARG-----KPRRGMLRRAVFSDVQRKALEK 198

  Fly   135 VFERTHY---PDAFVREELATKVHLSEARVQVWFQNRRAKFRRNERSVGSRTLLDTA---PQLVP 193
            .|::..|   ||   |::||:|:.|.:::|::||||||.|:|.::    .|.||.:.   .|.:|
Mouse   199 TFQKQKYISKPD---RKKLASKLGLKDSQVKIWFQNRRMKWRNSK----ERELLSSGGCREQTLP 256

  Fly   194 APISNNMHKYANMPHPHP------QPPP------PPGAYALNFGPLELR 230
            ..:           :|||      |..|      .|||......|.:.|
Mouse   257 TKL-----------NPHPDLSDVGQKGPGDEEEDNPGARLAYHAPADPR 294

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9876NP_611756.1 Homeodomain 118..174 CDD:459649 27/61 (44%)
Dbx1NP_001005232.1 PRK12323 <49..182 CDD:481241 14/47 (30%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 58..102
Homeodomain 184..238 CDD:459649 25/56 (45%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 240..335 15/70 (21%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.