DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9876 and DMBX1

DIOPT Version :10

Sequence 1:NP_611756.1 Gene:CG9876 / 37668 FlyBaseID:FBgn0034821 Length:275 Species:Drosophila melanogaster
Sequence 2:NP_671725.1 Gene:DMBX1 / 127343 HGNCID:19026 Length:382 Species:Homo sapiens


Alignment Length:166 Identity:60/166 - (36%)
Similarity:85/166 - (51%) Gaps:17/166 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 NIMEMKHDAYSKGKMAMELSSNFGPTGAGCGGADRPAPCSGN---LPAGGGHHSRKPRRNRTTFS 125
            |.:...::.:.:.....:.:.::.|:......|:|.|.|:..   |.|..|...||.||:||.|:
Human    15 NSLSAMYNLHQQAAQQAQHAPDYRPSVHALTLAERLAGCTFQDIILEARYGSQHRKQRRSRTAFT 79

  Fly   126 SAQLTALEKVFERTHYPDAFVREELATKVHLSEARVQVWFQNRRAKFRRNERSVGSRTLLDTAPQ 190
            :.||.||||.|::|||||..:||.||...:|.||||||||:|||||||:.:||:...       |
Human    80 AQQLEALEKTFQKTHYPDVVMRERLAMCTNLPEARVQVWFKNRRAKFRKKQRSLQKE-------Q 137

  Fly   191 LVPAPISNNMHKYANMPHPHP-------QPPPPPGA 219
            |.....:...|.......|.|       |||..||:
Human   138 LQKQKEAEGSHGEGKAEAPTPDTQLDTEQPPRLPGS 173

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9876NP_611756.1 Homeodomain 118..174 CDD:459649 36/55 (65%)
DMBX1NP_671725.1 Interaction with OTX2 and is required for repressor activity. /evidence=ECO:0000250|UniProtKB:Q91ZK4 1..156 53/147 (36%)
Homeodomain 72..128 CDD:459649 36/55 (65%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 128..252 12/53 (23%)
OAR. /evidence=ECO:0000255|PROSITE-ProRule:PRU00138 359..372
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.