DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9876 and Vsx2

DIOPT Version :10

Sequence 1:NP_611756.1 Gene:CG9876 / 37668 FlyBaseID:FBgn0034821 Length:275 Species:Drosophila melanogaster
Sequence 2:NP_001288356.1 Gene:Vsx2 / 12677 MGIID:88401 Length:380 Species:Mus musculus


Alignment Length:189 Identity:61/189 - (32%)
Similarity:77/189 - (40%) Gaps:68/189 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 PVGNPGNFYYGPTVSGEIYSSHQSHNLE---------------SEDKLEDREESGRNLDKIHRFS 61
            |.|.|| ||..||.. |:.|..||.:|:               |.|. ||...|.|.:.|     
Mouse    81 PGGLPG-FYTQPTFL-EVLSDPQSVHLQPLGRASGPLDTSQTASSDS-EDVSSSDRKMSK----- 137

  Fly    62 VDNIMEMKHDAYSKGKMAMELSSNFGPTGAGCGGADRPAPCSGNLPAGGGHHSRKPRRNRTTFSS 126
                     .|.::.|                                    .||.||:||.|:|
Mouse   138 ---------SALNQTK------------------------------------KRKKRRHRTIFTS 157

  Fly   127 AQLTALEKVFERTHYPDAFVREELATKVHLSEARVQVWFQNRRAKFRRNERSVGSRTLL 185
            .||..|||.|...||||.:.||.||.|..|.|.|:||||||||||:|:.|:..|..:::
Mouse   158 YQLEELEKAFNEAHYPDVYAREMLAMKTELPEDRIQVWFQNRRAKWRKREKCWGRSSVM 216

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9876NP_611756.1 Homeodomain 118..174 CDD:459649 34/55 (62%)
Vsx2NP_001288356.1 Homeodomain 153..205 CDD:459649 31/51 (61%)
OAR 319..337 CDD:461067
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.