DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9876 and Cdx4

DIOPT Version :10

Sequence 1:NP_611756.1 Gene:CG9876 / 37668 FlyBaseID:FBgn0034821 Length:275 Species:Drosophila melanogaster
Sequence 2:NP_031700.1 Gene:Cdx4 / 12592 MGIID:88362 Length:282 Species:Mus musculus


Alignment Length:117 Identity:34/117 - (29%)
Similarity:46/117 - (39%) Gaps:26/117 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    84 SNFGPTGAGCGGADRPAPCSGNL------------PAGGGH--------------HSRKPRRNRT 122
            |..|||.....|...|...|.:|            |:...|              .:|...:.|.
Mouse   112 STLGPTSGASNGGSLPDAASESLVSLDSGTSGATSPSRSRHSPYAWMRKTVQVTGKTRTKEKYRV 176

  Fly   123 TFSSAQLTALEKVFERTHYPDAFVREELATKVHLSEARVQVWFQNRRAKFRR 174
            .::..|...|||.|....|.....:.|||..:.|||.:|::||||||||.|:
Mouse   177 VYTDHQRLELEKEFHCNRYITIRRKSELAVNLGLSERQVKIWFQNRRAKERK 228

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9876NP_611756.1 Homeodomain 118..174 CDD:459649 22/55 (40%)
Cdx4NP_031700.1 Caudal_act 13..168 CDD:461413 10/55 (18%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 13..36
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 98..156 10/43 (23%)
Homeodomain 173..228 CDD:459649 22/54 (41%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.