DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9876 and Arx

DIOPT Version :9

Sequence 1:NP_611756.1 Gene:CG9876 / 37668 FlyBaseID:FBgn0034821 Length:275 Species:Drosophila melanogaster
Sequence 2:NP_001292869.1 Gene:Arx / 11878 MGIID:1097716 Length:564 Species:Mus musculus


Alignment Length:273 Identity:83/273 - (30%)
Similarity:114/273 - (41%) Gaps:80/273 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 ESEDKLEDREESGRNLDKIHRFSVDNIMEMKHDAYSKGKMAMELS-SNFGPTGAGCGGADRPAPC 102
            :.|:.|||.|:.....:.:..   |:...::.||.:..|.....| :..|...|....|......
Mouse   225 DEEELLEDEEDEEEEEELLED---DDEELLEDDARALLKEPRRCSVATTGTVAAAAAAAAAAVAT 286

  Fly   103 SGN-------------------------LPAGG----GHHSRKPRRNRTTFSSAQLTALEKVFER 138
            .|.                         |.||.    |...||.||.||||:|.||..||:.|::
Mouse   287 EGGELSPKEELLLHPEDAEGKDGEDSVCLSAGSDSEEGLLKRKQRRYRTTFTSYQLEELERAFQK 351

  Fly   139 THYPDAFVREELATKVHLSEARVQVWFQNRRAKFRRNERSVGSRTLLDTAPQLVPAPIS--NNMH 201
            |||||.|.|||||.::.|:||||||||||||||:|:.|:: |::|.....|  .|.|:|  :.:.
Mouse   352 THYPDVFTREELAMRLDLTEARVQVWFQNRRAKWRKREKA-GAQTHPPGLP--FPGPLSATHPLS 413

  Fly   202 KYANM----PH-----------------PHPQPPPPPGAYALNFGPLELRSCQNYTNCYGGFGSS 245
            .|.:.    ||                 ..|..|||||:.:|                    ..|
Mouse   414 PYLDASPFPPHHPALDSAWTAAAAAAAAAFPSLPPPPGSASL--------------------PPS 458

  Fly   246 GASGSGVCSFFGA 258
            ||. .|:.:|.||
Mouse   459 GAP-LGLSTFLGA 470

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9876NP_611756.1 Homeobox 121..173 CDD:278475 36/51 (71%)
ArxNP_001292869.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..21
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 54..79
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 111..264 9/41 (22%)
Homeobox 334..386 CDD:278475 36/51 (71%)
OAR 528..545 CDD:281777
OAR. /evidence=ECO:0000255|PROSITE-ProRule:PRU00138 532..545
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24329
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.