DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9876 and Alx4

DIOPT Version :9

Sequence 1:NP_611756.1 Gene:CG9876 / 37668 FlyBaseID:FBgn0034821 Length:275 Species:Drosophila melanogaster
Sequence 2:NP_031468.1 Gene:Alx4 / 11695 MGIID:108359 Length:399 Species:Mus musculus


Alignment Length:225 Identity:79/225 - (35%)
Similarity:99/225 - (44%) Gaps:63/225 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    89 TGAGCGGADRPAPCSGNLPA-----GGGHHSRKPRRNRTTFSSAQLTALEKVFERTHYPDAFVRE 148
            |||. |..||   .|..:|:     ....:..|.|||||||:|.||..|||||::|||||.:.||
Mouse   173 TGAK-GPQDR---ASAEIPSPLEKTDSESNKGKKRRNRTTFTSYQLEELEKVFQKTHYPDVYARE 233

  Fly   149 ELATKVHLSEARVQVWFQNRRAKFRRNERSVGS----RTLLDTAPQLVPAPISNNMHKYANM--- 206
            :||.:..|:||||||||||||||:|:.|| .|.    ||...||.:|   |:......||.:   
Mouse   234 QLAMRTDLTEARVQVWFQNRRAKWRKRER-FGQMQQVRTHFSTAYEL---PLLTRAENYAQIQNP 294

  Fly   207 ---------------------------PHPHPQPPPPPGAYALNFGPLELRSCQNYTNCYGGFGS 244
                                       ||.|     |||:.|        .|..::.:..|....
Mouse   295 SWIGNNGAASPVPACVVPCDPVPACMSPHAH-----PPGSGA--------SSVSDFLSVSGAGSH 346

  Fly   245 SGASGSGVCSFFGATNYCVAAN-YAKNAYP 273
            .|.:..|  |.|||.......| |..|..|
Mouse   347 VGQTHMG--SLFGAAGISPGLNGYEMNGEP 374

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9876NP_611756.1 Homeobox 121..173 CDD:278475 36/51 (71%)
Alx4NP_031468.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 68..133
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 171..206 11/36 (31%)
Homeobox 206..258 CDD:278475 36/51 (71%)
OAR 375..392 CDD:281777 79/225 (35%)
OAR. /evidence=ECO:0000255|PROSITE-ProRule:PRU00138 379..392
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24329
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.