DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9876 and Vsx1

DIOPT Version :10

Sequence 1:NP_611756.1 Gene:CG9876 / 37668 FlyBaseID:FBgn0034821 Length:275 Species:Drosophila melanogaster
Sequence 2:NP_473409.1 Gene:Vsx1 / 114889 MGIID:1890816 Length:363 Species:Mus musculus


Alignment Length:239 Identity:61/239 - (25%)
Similarity:87/239 - (36%) Gaps:91/239 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 LESEDKLEDREESGRNL--------DKIHRFSVDNIMEMKHD---------AYSKGKMAMELSSN 85
            :...|.|.|.....|.|        .::..|::::::.::.|         ..:.|..|..:.|.
Mouse     1 MTGRDGLSDARSRSRALAPGCPPTGSRLRSFAINDLLGLEADLPTPAEPGLRSNSGDPAEAIGSG 65

  Fly    86 FGPTGAGCG------------------GADRPA------------------PCSGNLPA------ 108
            .||....||                  ||..|:                  |.:|..||      
Mouse    66 PGPGPGLCGSCPARGALPLGLGLLCGFGAQPPSAAAAARARCLLLADLRLLPSAGPEPAVAQGPV 130

  Fly   109 ------GGGHHS--------------------------RKPRRNRTTFSSAQLTALEKVFERTHY 141
                  |....|                          ||.||:||.|::.||..|||.|...||
Mouse   131 HPPPALGSQQRSESVSTSDGDSPSEEKNDPKMSLILGKRKKRRHRTVFTAHQLEELEKAFGEAHY 195

  Fly   142 PDAFVREELATKVHLSEARVQVWFQNRRAKFRRNERSVGSRTLL 185
            ||.:.||.||.|..|.|.|:||||||||||:|:.|:..|..:::
Mouse   196 PDVYAREMLAAKTELPEDRIQVWFQNRRAKWRKREKRWGGSSVM 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9876NP_611756.1 Homeodomain 118..174 CDD:459649 33/55 (60%)
Vsx1NP_473409.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..25 5/23 (22%)
Octapeptide motif 31..38 1/6 (17%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 42..66 4/23 (17%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 122..166 4/43 (9%)
Nuclear localization signal. /evidence=ECO:0000255 168..173 2/4 (50%)
Homeodomain 172..228 CDD:459649 33/55 (60%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 300..363
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.