DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9876 and Prrx2

DIOPT Version :9

Sequence 1:NP_611756.1 Gene:CG9876 / 37668 FlyBaseID:FBgn0034821 Length:275 Species:Drosophila melanogaster
Sequence 2:NP_001099209.1 Gene:Prrx2 / 113931 RGDID:1311471 Length:248 Species:Rattus norvegicus


Alignment Length:185 Identity:84/185 - (45%)
Similarity:108/185 - (58%) Gaps:31/185 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 FSVDNIMEMKHDAYS--------KGKMAMELSSNFGPTGAGCGGADRPAPCSGNLPAGGGHHS-- 114
            |||.::::::..|.:        .|..|.|.::. .|:|...|  ...||..|.. |..||.|  
  Rat    33 FSVSHLLDLEEVAAAGRRAAGPVPGPEAREGAAR-EPSGGSSG--SEAAPQDGEC-AAPGHGSAT 93

  Fly   115 ---RKPRRNRTTFSSAQLTALEKVFERTHYPDAFVREELATKVHLSEARVQVWFQNRRAKFRRNE 176
               :|.|||||||:|:||.|||:|||||||||||||||||.:|:|||||||||||||||||||||
  Rat    94 KRKKKQRRNRTTFNSSQLQALERVFERTHYPDAFVREELARRVNLSEARVQVWFQNRRAKFRRNE 158

  Fly   177 RSV---GSRTLLDTAPQ-------LVPAPISNNMHKYANMPHPHPQ---PPPPPG 218
            |::   .|.:||.:..|       :.|.|.:.: ..|.:.|...|.   ||..||
  Rat   159 RAMLATRSASLLKSYGQEAAIEQPVAPRPTTLS-PDYLSWPASSPYSSVPPYSPG 212

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9876NP_611756.1 Homeobox 121..173 CDD:278475 44/51 (86%)
Prrx2NP_001099209.1 Homeobox 104..156 CDD:395001 44/51 (86%)
COG5576 <110..214 CDD:227863 58/104 (56%)
OAR 222..238 CDD:397759
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 105 1.000 Domainoid score I6517
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 123 1.000 Inparanoid score I4636
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000011
OrthoInspector 1 1.000 - - otm45609
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X3194
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
87.960

Return to query results.
Submit another query.